General Information

  • ID:  hor005676
  • Uniprot ID:  P33689
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SSPETMLSDVWWRENTENIPRSRFEDPPMW
  • Length:  30(68-97)
  • Propeptide:  MQGNMRLWMSVLTLCLSMLICLGTFAEAYPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRYGKRSSPETMLSDVWWRENTENIPRSRFEDPPMW
  • Signal peptide:  MQGNMRLWMSVLTLCLSMLICLGTFAEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P33689-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005676_AF2.pdbhor005676_ESM.pdb

Physical Information

Mass: 421147 Formula: C163H238N44O51S2
Absent amino acids: ACGHKQY Common amino acids: EPS
pI: 4.1 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 7
Hydrophobicity: -120.33 Boman Index: -9291
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 35.67
Instability Index: 8268.33 Extinction Coefficient cystines: 16500
Absorbance 280nm: 568.97

Literature

  • PubMed ID:  NA
  • Title:  NA